Protein Info for QEN71_RS11455 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 148 to 182 (35 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 366 (354 residues), 200.5 bits, see alignment E=1.9e-63

Best Hits

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_5929)

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>QEN71_RS11455 MFS transporter (Paraburkholderia sabiae LMG 24235)
MRKMRWVVIFLSFLAIAVNYIDRANLAVAAPEIEKALGIGPAEMGFILSGFFWTYALMQM
PFGWFVDRVGARIALPLAVGWWSVFTALTAATSSVAGMFGCRLLLGVGEAGAYPSCAKLV
SQWFPVKERALATSIFDSGSRVGSALSIPVVALIISSVGWKAAFVITGALGAVWILGWFV
IYRNPEPHDTGSSKAAANAPGVRQRQRVTWGSLFRHRTLWGMMLGFFCLNFVIYFFITWF
PSYLVQTRGFSLKSLGTLGMIPALISIPGGWLGGYVSDALFRRGWSLTAARKTCMVGGML
LSSVITLSAFTANVYLMLAFFGIAYGSLAFAAASIWSLPGDVAPTPDHVASIGGIQNFAS
NLAGIVITTFTGVMVAMTKGSFTIPLVVAGGFCFLGAFSYLVIVGRIEPLSIASDSEEAS
TRVTSTI