Protein Info for QEN71_RS11340 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 120 (109 residues), 65.6 bits, see alignment E=2.3e-22 PF00528: BPD_transp_1" amino acids 31 to 226 (196 residues), 69.2 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 36% identical to ARTM_HAEIN: Arginine ABC transporter permease protein ArtM (artM) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10015, histidine transport system permease protein (inferred from 77% identity to bac:BamMC406_6602)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>QEN71_RS11340 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MTYEQFGQLFSSYASGLWVTVQLTVLSLSLGLLIAIPLAVLRVSPKRVVSGSVAVYTWFM
RGTPLLAQLMIVYYGFGQFQWMQDAWQRGNPVLSLLRDPYWCALIALTANTCAYTTEILA
GALRATPYGEIEAAQAYGMSRMMAWRRILLPSALRRFIPAYSNEVILMLHGTSIVSAITI
VDLTGVARDFYANYYAPFEAFISVGTVYFGLTTIITFLVRLTERRYLVYLRPQNFATLAK
G