Protein Info for QEN71_RS11230 in Paraburkholderia sabiae LMG 24235

Annotation: Rieske 2Fe-2S domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00355: Rieske" amino acids 53 to 136 (84 residues), 71.6 bits, see alignment E=4.1e-24 PF00848: Ring_hydroxyl_A" amino acids 197 to 379 (183 residues), 74.1 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_6040)

Predicted SEED Role

"GbcA Glycine betaine demethylase subunit A" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>QEN71_RS11230 Rieske 2Fe-2S domain-containing protein (Paraburkholderia sabiae LMG 24235)
MANPASTITAQALVDQLQTGCERSFGEARSMPPGVYTSPEFLALEERDIFAREWQCVGRA
SALKAPGDYLTARIGAQPIVVLRDEQMQLKAMSNVCLHRISVLLEGRGNVRRIVCPYHAW
NYSLDGALKGAPLMDRQEGFCKESYRLPTLRCETWQGWIYVTLDQTAPPVHVQLADLSEL
IGAYGMSDYIETFHEEHVWDTNWKILAENFMESYHLPMLHRATVGPHSRLEEMECPPGFP
AFNYHWITKEASLPIGNAHPDNTRLTGHWRKTTALLAIYPTHLVTLTPGYFWYLVLQPEG
VGRVHIRFGGGLAPEFIADPQAQAHMATLKTLLDEVNAEDRRGVEAVFRGVHAPLAKPGH
LSHLERPNYDFARYLAAKLRAH