Protein Info for QEN71_RS11140 in Paraburkholderia sabiae LMG 24235

Annotation: CoA-acylating methylmalonate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 161 to 170 (10 residues), see Phobius details TIGR01722: methylmalonate-semialdehyde dehydrogenase (acylating)" amino acids 13 to 489 (477 residues), 655.8 bits, see alignment E=1.9e-201 PF00171: Aldedh" amino acids 24 to 485 (462 residues), 468.9 bits, see alignment E=1.6e-144 PF05893: LuxC" amino acids 141 to 277 (137 residues), 22.5 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 59% identical to BAUC_PSEAE: Putative 3-oxopropanoate dehydrogenase (bauC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 86% identity to bpy:Bphyt_5671)

MetaCyc: 60% identical to malonate-semialdehyde dehydrogenase (acetylating) (Halomonas sp. HTNK1)
Malonate-semialdehyde dehydrogenase (acetylating). [EC: 1.2.1.18]

Predicted SEED Role

"Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.2.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.27

Use Curated BLAST to search for 1.2.1.18 or 1.2.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>QEN71_RS11140 CoA-acylating methylmalonate-semialdehyde dehydrogenase (Paraburkholderia sabiae LMG 24235)
MSEANRSSVRELNHFIDGRLVAGASGQFADVFDPAQGRPSARVPVANADEVAAAVAAAKA
AFPAWSETPPLKRARLMFKFKELLEKHSDEIAELITRDHGKLFEDSKGEVLRGIEIVEFA
CGIPDLLKTDFTDQIGIGMDAWNLRQPLGVSAGVTPFNFPVVVPCWMFVMAAATGNTFIL
KPSERTPSASIRLAELFIEAGFPKGVFNVVHGSKAVVDALMAHPDVMAMSAVASTPVAEY
IYTESAKHGKRVQALGSAKNHLVVMPDANLDRTIDALINSSYGSAGERCMATSVAVAVGD
IGDELVERLVPRVRSLRIGSGMEPNLDMGPLISAAHRNKVVGYIEAGVAEGARLLVDGRG
HTVTGHEEGFFLGGSLFDDVKPDMRIYREEIFGPVLSVVRVPDLASAIALVNAHELGNCV
SLYTSDGNAARTFSRQIKVGMVGINVPSPVPSAWHSFGGWKRSLFGDHHAYGEEAVRFYT
HYKSVMQHWPEDIVGKAA