Protein Info for QEN71_RS10895 in Paraburkholderia sabiae LMG 24235

Annotation: cyclic di-GMP phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 TIGR00229: PAS domain S-box protein" amino acids 116 to 234 (119 residues), 56.5 bits, see alignment E=3.1e-19 PF00989: PAS" amino acids 117 to 161 (45 residues), 25.6 bits, see alignment 2.7e-09 PF13426: PAS_9" amino acids 125 to 226 (102 residues), 38.4 bits, see alignment E=3.2e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 235 to 396 (162 residues), 127.1 bits, see alignment E=5.8e-41 PF00990: GGDEF" amino acids 238 to 392 (155 residues), 153.9 bits, see alignment E=8.2e-49 PF00563: EAL" amino acids 414 to 647 (234 residues), 241.7 bits, see alignment E=1.8e-75

Best Hits

Swiss-Prot: 57% identical to PDER_ECOLI: Cyclic di-GMP phosphodiesterase PdeR (pdeR) from Escherichia coli (strain K12)

KEGG orthology group: K14051, cyclic di-GMP phosphodiesterase Gmr [EC: 3.1.4.52] (inferred from 96% identity to bph:Bphy_5279)

MetaCyc: 57% identical to cyclic di-GMP phosphodiesterase PdeR (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"FOG: PAS/PAC domain"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (667 amino acids)

>QEN71_RS10895 cyclic di-GMP phosphodiesterase (Paraburkholderia sabiae LMG 24235)
MNDDQHDQVLFARFGTSSPCWRLSSDSNALELTPETEDDAATVAIALSGAQAAQIRRLTG
VTSHLTMDVRLYGEALRLHLVGKKLNGSTWAGTASAYEDTESVARDLVHGLSFAEQVVSE
VNSVVVIVDRAGRIQRFNRLAEELTGMKEEDVIGRNVWALFMSSEAGAASSQNISGFFQE
GVAYEVERRVRTVHGERLFLFRNKFVMSGSGVDEQFLICSGTDITKERNAQERLSELANT
DSLTGLPNRNAIHDKTRAAIESAAPGDALGILFLDLDNFKKVNDHYGHVFGDRLIQDVSS
AVRECLADEDTLARLGGDEFIVLSPVASVASMEAMAQRILERLRTPFSLGLVEVYTGCSI
GIAMFPEHGDSLEALIRAADTAMYVAKDDGKRTYRVFSPEMNRKVAEYMWLDTNLRRGLE
EGQLTLHYQPKLSLSTGTVYGVEALVRWNSPERGQIMPAAFIRYAEESGLIGPLGRWVMQ
TAAEQAAQWKAHGLSLRVAINVSARQLVDTAVVAHFNEALERAQLDPCLLDIELTESCLI
EDEAAAIDLITQFRDLGAQVHLDDFGTGYSSLSQLGRIPLDVIKLDRSFVSSINADRKSQ
ALVRSMVAVAQALQLQVVAEGIETEAEELFMKGLGVEYVQGYLYGKPMPAADFERWLHDR
QKIRLIA