Protein Info for QEN71_RS10865 in Paraburkholderia sabiae LMG 24235

Annotation: GT4 family glycosyltransferase PelF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 PF11997: DUF3492" amino acids 15 to 295 (281 residues), 352.3 bits, see alignment E=3.7e-109 PF00534: Glycos_transf_1" amino acids 320 to 473 (154 residues), 81.2 bits, see alignment E=1e-26 PF13692: Glyco_trans_1_4" amino acids 322 to 471 (150 residues), 83.7 bits, see alignment E=2.3e-27

Best Hits

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_5285)

Predicted SEED Role

"Extracellular matrix protein PelF, glycosyltransferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>QEN71_RS10865 GT4 family glycosyltransferase PelF (Paraburkholderia sabiae LMG 24235)
MSSSNTPALPHAESADIALLLEGTFPYVSGGVSSWVNQIIRAFPQYSFALCFLGSRPQDY
PKMQYTLPDNVVHLENHYLYDFAPPPLVQKQRGEASAFMRSAHLHDALRNPAMRHAAGRM
LKDMLKDLRPGGALGEDAFLYSKEAWNYLTDQYRQFCTDPSFVDYFWTVRIMHKPLWQLA
KIAEGLPRVKMFHTVSTGYAGFLGALARYRHARPLLVSEHGIYTKERKIDLFQSEWIRDN
RSIFERDVSQIGYFRDLWVRFFETLGHVCYDAAEDIIALYEGNRQRQILDGAPEDKTANI
PNGVNLPKLAPLRAQRASGVPKTLCLIGRVVPIKDIKTFIRAMLTVVRRMPEAEAWIAGP
ENEDPSYAAECHALVESLGLQDKVRFLGFQKIDELLPKCGVLVLSSISEALPLVVLEGFA
AGVPSVTTDVGSCRQLIYGLEGDDAALGAAGRVVQIADPRALAEAALDLLDENNWHTAQQ
AGIARVERYYTQEQMVGSYRDLYARLTSQTDIVDPPASEADLMQMPH