Protein Info for QEN71_RS10550 in Paraburkholderia sabiae LMG 24235

Annotation: YSC84-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04366: Ysc84" amino acids 108 to 191 (84 residues), 58 bits, see alignment E=4.4e-20

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_5337)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>QEN71_RS10550 YSC84-related protein (Paraburkholderia sabiae LMG 24235)
MHRRKFILSTSAALAAGGLALSGCTMTGSHSTNSASNADKRRAIDSSVDETLSRLYTTAH
GSRELVSKARGVLVFPSVVQAGFWIGGQYGQGSLRVGGQTVGYYSTAAGSFGLQIGAQSK
GVVFLFMTQDALDQFRNSKGWSVGGDATVALVKVGANGNIDTTTATKPVQAFVLTNAGLM
AGVSLEGAKISRLDI