Protein Info for QEN71_RS10505 in Paraburkholderia sabiae LMG 24235

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 246 to 274 (29 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 344 to 370 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 29 to 138 (110 residues), 42.4 bits, see alignment E=2.6e-15 amino acids 183 to 367 (185 residues), 123 bits, see alignment E=8.2e-40

Best Hits

KEGG orthology group: None (inferred from 94% identity to bph:Bphy_5344)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>QEN71_RS10505 AI-2E family transporter (Paraburkholderia sabiae LMG 24235)
MKLPLTPQRPSPNRVYPPGTPGLHGLTSVITFVVVVCGLYFAREVLIPITLAVLLSFLLA
PLVSLLRRLHFGQLPSIFVAVLTAVVTLLAVSTLIGAQVAQLAGSLPQYQAAIERKVETV
QEKTVGRADALLSRAAAALARVAPERETPPHEAGRSQKPTVAAPLPVEVHEPIPSPLEVA
QRVFSPVVGPLETMFIVLVVTIFILLQREDLRDRLIRLFGARDLHRTTTAINDAASRLSR
YFVAQLGVNLGAGATIAIGLAIIGVPGALLFGVLTALLRFVPYIGTWIAGLLAVILAAAI
QPQWTMAVWTIVLFVTIDVVAGQVVEPLLYGHSSGLSPLAVVVAAIFWSWLWGPIGLVLS
TPLTLCLVTLGRYGERLKFLTVLLGDQPALTPAQNFYQRLLADDPHEAIVQADRFLREMP
LTRYYDDVAREGLRLARNDTLRGVFAPEQMARMNETLLDIVENLEQVEGMPEDKADAHAP
DALPALSPEDAAQQHVVCVAGRGAFDEVTTAIAVQLLTRRGFAPVTANYAQFRRGQAEAL
GADGAAIVCVITLDAPEAPPYLRNLLRRIRERAPGAHLIVGIGGQSERVDEVGALSGTHN
ANGFSDLVSQCMQAASARSAQAAVEPTPRGVDA