Protein Info for QEN71_RS10215 in Paraburkholderia sabiae LMG 24235

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details PF00892: EamA" amino acids 5 to 134 (130 residues), 27.3 bits, see alignment E=1.8e-10 amino acids 145 to 274 (130 residues), 55.6 bits, see alignment E=3.2e-19

Best Hits

Swiss-Prot: 52% identical to Y1977_PSEAE: Uncharacterized protein PA1977 (PA1977) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 86% identity to bph:Bphy_5364)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>QEN71_RS10215 DMT family transporter (Paraburkholderia sabiae LMG 24235)
MPRMRIVLLTIVAMFAFAGNSLLCRVALKGTSIDPATFTSVRIVSAAIALWIVLRTRGES
QRIGGNWLSAFALFAYAAAFSFAYVSLAAGTGALLLFGAVQATMIGYALARGERLRALQW
IGLICALAGLVALVLPGVSAPPPLASLLMLCAGIAWGIYSLRGKRAADPTVTTAGNFIRA
IPFAIAISAAMFTHASIDKTGLLFAAISGALTSGVGYVIWYAALKHIPSATAATVQLSVP
LIAAAGGIALLAEPLTARLALSALAILGGIALVVVRR