Protein Info for QEN71_RS09855 in Paraburkholderia sabiae LMG 24235

Annotation: peptide-methionine (S)-S-oxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 60 to 209 (150 residues), 165.2 bits, see alignment E=7.1e-53 PF01625: PMSR" amino acids 61 to 213 (153 residues), 193 bits, see alignment E=1.8e-61

Best Hits

Swiss-Prot: 46% identical to MSRA_DEIRA: Peptide methionine sulfoxide reductase MsrA (msrA) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 93% identity to bph:Bphy_5423)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>QEN71_RS09855 peptide-methionine (S)-S-oxide reductase MsrA (Paraburkholderia sabiae LMG 24235)
MNKKLIANAFGWTRTSAGRIAACVAIGAGAIAWQHVASAEQAVRIPAPTQDEKVGATHTE
TAVFAGGCFWGVQGVYEHVKGVQQVASGYTGGAANTAQYETVSDGETGHAESVRITYDPT
QITYGRLLQIFFSVAHNPTQLNYQGPDHGTQYRSAVFPQNAEQRAIAQAYIAQLGKAKVF
NAPIVTKVEDFKGFYPAEQYHQNYLVLHPDSPYIAINDLPKITYLKQMFPEIYRNDPVLL
KTSAS