Protein Info for QEN71_RS09820 in Paraburkholderia sabiae LMG 24235

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 326 to 345 (20 residues), see Phobius details PF00672: HAMP" amino acids 343 to 394 (52 residues), 31.2 bits, see alignment 2.2e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 407 to 566 (160 residues), 145.6 bits, see alignment E=5.7e-47 PF00990: GGDEF" amino acids 411 to 566 (156 residues), 163.4 bits, see alignment E=3.8e-52

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_5430)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>QEN71_RS09820 diguanylate cyclase (Paraburkholderia sabiae LMG 24235)
MMRPGLTFKLSVLLALIGVLASGTTGFYAYRANRTMLVHEAERSLLTSTELLGQRFTVAI
NDIAADALVLSTMPSAANIAMSDDGTSLENPARDRLAQVFASFIVQHPEYLQVRLIARNH
YGLELIRLDRESGGAVRVQESALQEKGQFAYVFETLALQPGRVYISPIAVNHEHGAHAAE
GKPTLRVGTPVANARGEVVGAVVIDVDLASLLRLSQADLPTDYQVYLANEWGDFLVHPDP
SQTFGFDKGRRVFMQDSFAATKHLFEQSTQPVLLNGLTQPNVAQGHVLAFVRRPFGESQG
NRFLVIGLAKPLHDVLVGANMLGNSIVRMVLIFSAFAILLAILFARALTRPLHTLADAAT
HFFSEHTMDALPVRRTDEIGVLARGFERMRREIRVQMDELRSKQHELTHLASHDGLTGLP
NRMLFMQKLEEAIDRARVNGSRLAVLFIDLNRFKQINDQYGHSVGDDVLAIVARRLQQVL
HPGDVVARLGGDEFIVLVKGERSAEAAPAIAARIVRTIDDELLIGDQPMAVGASIGISQF
PSDGDSAEALLLNADAAMYAAKSGGSGAWLSYRELIDLQRTRATREPQRQIEREAEKVEP
AGDGADVIV