Protein Info for QEN71_RS09805 in Paraburkholderia sabiae LMG 24235

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 215 to 240 (26 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 14 to 353 (340 residues), 63.6 bits, see alignment E=8.8e-22

Best Hits

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_5433)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>QEN71_RS09805 acyltransferase (Paraburkholderia sabiae LMG 24235)
MRATTTQANGIVPALTSIRFLAALTVVLSHYRELDLLNTPLPFFDFVDGGRSAVSLFFVL
SGFILTYTYRDELATQSPHNFYVARVARIYPNILLALAIASITTAYLVISHNDVLLLKWF
ALKSSINLSLVVSFIAQVLLITAWFPFAAINQPWNGPASSVSCEAFFYALFPLILARFVK
MRASTLAATLVGVWIAQGLMIVFFMVVFPASRSHFLAGALPLCRIAEFMLGIGAALAFQA
LRARGVSMHKRGIALVSGSVVVLIILALWQPVSPVFYPQSPFFATLILGLALLERPVLGV
LNQRWLVRFGEASYALFLIHVPLAYLAWLAGFRVNNGWIPLVFTLLFSVVVFTYFEEPMR
RRIRSRFRSKPLVPAAVVADAVDPSVTVGPGMKPG