Protein Info for QEN71_RS09790 in Paraburkholderia sabiae LMG 24235

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 297 (201 residues), 58.3 bits, see alignment E=4.4e-20

Best Hits

Swiss-Prot: 36% identical to Y1215_PYRHO: Probable ABC transporter permease protein PH1215 (PH1215) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 94% identity to bph:Bphy_5436)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>QEN71_RS09790 sugar ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MTTKSRPAAKAHGRPLRKRWSLAAWIALIPMILTVIFAYLGTMLWTARVSLSNSRTFPSN
DFVGFTQYVRLFHNDRWLVSLQHIAIYGVCFIVACLAIGMLLAIFIDQRVMAEGVLRTVF
LYPYAMSFVATGLVWQWILNPELGAQSLLHKMGFTHARFDWIVDQDWVIYTIVIATVWQA
SGLVMAVMLAGLRGIDDELWKAARIDGIPRWRVYASIVIPMLGPSISTAFVLLFVAVVKL
FDAVVAMTQGGPGTASEVPAKFIMDYLFGRANIGLASAASIVLLATVLAILAPFLYARSR
NASRKEV