Protein Info for QEN71_RS09770 in Paraburkholderia sabiae LMG 24235

Annotation: PaaI family thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF03061: 4HBT" amino acids 43 to 116 (74 residues), 26.6 bits, see alignment E=3.1e-10

Best Hits

KEGG orthology group: None (inferred from 73% identity to bge:BC1002_3878)

Predicted SEED Role

"Uncharacterized protein, possibly involved in aromatic compounds catabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>QEN71_RS09770 PaaI family thioesterase (Paraburkholderia sabiae LMG 24235)
MQPPPLDNPFLESLAVELTEWRSGYAEFTMPIRPETLNRQRVLQGGAIATLLDAAAGYSG
LYSEGDPVHAFTLSLTISYLDKGLGEKVISKGFLERKGRSVFFARAEAWVDGRVLIASAQ
GVFKYA