Protein Info for QEN71_RS09505 in Paraburkholderia sabiae LMG 24235

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 5 to 301 (297 residues), 211.6 bits, see alignment E=6.2e-66 PF00070: Pyr_redox" amino acids 146 to 224 (79 residues), 57.3 bits, see alignment E=6.3e-19 PF13450: NAD_binding_8" amino acids 149 to 185 (37 residues), 23.6 bits, see alignment 1.8e-08 PF14759: Reductase_C" amino acids 323 to 407 (85 residues), 112.5 bits, see alignment E=4e-36

Best Hits

Swiss-Prot: 42% identical to ANDAA_BURCE: Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component (andAa) from Burkholderia cepacia

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 86% identity to bph:Bphy_6979)

MetaCyc: 42% identical to anthranilate dioxygenase reductase component (Burkholderia cepacia)
Anthranilate 1,2-dioxygenase (deaminating, decarboxylating). [EC: 1.14.12.1]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.3

Use Curated BLAST to search for 1.14.12.1 or 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>QEN71_RS09505 FAD-dependent oxidoreductase (Paraburkholderia sabiae LMG 24235)
MKRTLVIVGASYAGVQLAASVRELGFDDRIVLLGDEPDAPYQRPPLSKGFLTGSFAEERL
PLRSQAFFDEENIEWMPSTRATFIDRERREIELHDGSRIAYDHLALTTGARVRKLDCPGA
SLDAVHYLRDLRDAKRLAETARSTKRAVVIGGGYIGLEAAASLRQQGLDVTVVETESRLL
ARVASPWISDFMLRAHVQRGVAFELGRKVVALHDAYGVVSVELDNGTRVLCDLVVVGIGV
IPNTELAADCGLHVEGGITVDACARTGDPRIVAAGDCASLVPHWAPPGGRVCRIESVQNA
NDLAKTAAASILGRCEPYRAVPWFWSDQYDLKLQMAGVNSGFTDFAVRGSVEERKCSLFY
FRDNTLIAVDSINRPQDHMLARKLLASGAHVRAEEVRDPAFDLKSLVNGDAHALRGAA