Protein Info for QEN71_RS09440 in Paraburkholderia sabiae LMG 24235

Annotation: dihydroxyacetone kinase subunit DhaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 253 to 270 (18 residues), see Phobius details TIGR02363: dihydroxyacetone kinase, DhaK subunit" amino acids 1 to 324 (324 residues), 450.8 bits, see alignment E=1.3e-139 PF02733: Dak1" amino acids 18 to 323 (306 residues), 406.2 bits, see alignment E=3.9e-126

Best Hits

Swiss-Prot: 46% identical to DHAK_LACLA: PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK (dhaK) from Lactococcus lactis subsp. lactis (strain IL1403)

KEGG orthology group: K05878, dihydroxyacetone kinase, N-terminal domain [EC: 2.7.1.-] (inferred from 95% identity to bph:Bphy_6364)

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), dihydroxyacetone binding subunit DhaK" in subsystem Dihydroxyacetone kinases (EC 2.7.1.121)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.121

Use Curated BLAST to search for 2.7.1.- or 2.7.1.121

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>QEN71_RS09440 dihydroxyacetone kinase subunit DhaK (Paraburkholderia sabiae LMG 24235)
MKKFINNVDDFLTESLAGFAAAHSDLVVLNHEPVFVRRKTLKAGKVALISGGGSGHEPLH
SGFVGYGMLDAACPGQVFTSPTPDQMMAAAKAVDTGAGTLFIVKNYSGDLMNFEMASEMS
ELPNAMVLINDDVAVENSSYTTGRRGVAGAVIVEKMVGSLAESGANLEQCKAFGDRINKH
TASMGVAFSSCTVPAAGTLTFKIGDDEIEVGVGIHGEPGRRRASFAAADAIAGELLTAIV
ADLKPASDSNLLVLINGLGGTPLGELYLLFNSARSWLQQRDLKIARVQVGSLTTSLEMAG
ASITLCVLDDDMTRHWDSPVHTPSLRWGV