Protein Info for QEN71_RS09395 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 161 (142 residues), 137.1 bits, E=1.6e-43
• PF08402: TOBE_2
  • amino acids 275 to 352 (78 residues), 26.1 bits, E=1.9e-09

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 86% identity to bxe:Bxe_B1685)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Protein Sequence (362 amino acids)

>QEN71_RS09395 ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MTHLTLQAVTKQFGAARAVDSVDLTVPDGKLVCFLGPSGCGKTTLLRMIAGLEMPSAGSI
TFAGNDITRVPANQRDFGMVFQSLALFPHMTVAENIAYPLKLRKTGKTEQTRRVAELLDL
IQLPHMAARPVTQLSGGQRQRVAIARAIASSPKLLLLDEPLSALDAKLREAMQVEIRLLQ
QRLGITTIMVTHDQREAMTMADLIVVMEKGRIAQVGKPLDIYRDPVSEFVADFIGLGNIL
PVTFDGRGGASLPGGTQITVASPARGLDARGDLRLLIRPEDVHVRTANDAVPQTPRANCL
PGTVTFIRDVGASLEATIDCAGFTLTAATTPRETPGLELGMPVMAELPAHACKLIAARTA
VH