Protein Info for QEN71_RS09390 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 52 (52 residues), see Phobius details transmembrane" amino acids 88 to 110 (23 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 158 to 174 (17 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 278 (162 residues), 45.8 bits, see alignment E=3.1e-16

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 90% identity to bxe:Bxe_B1684)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>QEN71_RS09390 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSTQGGSVSMLPMRLPSTLPGRLGKVTTLLAAVVLFLAALPILTMIAMSFSASDTLEFPP
HAYSLQWYRAAWHTFVSPDANSALSMGTALATSLIVAASTMIIATLVSVPATYALSRYRF
RGKPAVEQLVALPLVYPLVMLGLSLLLVFNVLPVELGMFRLIIAHVILALPFTVKNCAAS
VASIGPEFEEAACVMGASPQRAMIDVVLPLMRPGILAGMLFAFIISFNEFTVTFFLYNID
TMTLPVWLYSRTVSSLDPTVFSFAVFIVAIDFALIWLLEKLIGDNGVAL