Protein Info for QEN71_RS09225 in Paraburkholderia sabiae LMG 24235

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 34 to 76 (43 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 140 to 140 (1 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 255 to 263 (9 residues), see Phobius details amino acids 265 to 273 (9 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 390 to 421 (32 residues), see Phobius details amino acids 520 to 541 (22 residues), see Phobius details TIGR00815: sulfate permease" amino acids 17 to 556 (540 residues), 381.3 bits, see alignment E=3.8e-118 PF00916: Sulfate_transp" amino acids 30 to 395 (366 residues), 279.2 bits, see alignment E=4.6e-87 PF01740: STAS" amino acids 450 to 555 (106 residues), 53.5 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: None (inferred from 75% identity to bph:Bphy_2397)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>QEN71_RS09225 SulP family inorganic anion transporter (Paraburkholderia sabiae LMG 24235)
MGNDARAHAAPRQFRIPVLDWTHGYRKEWLKPDVVAGVTAAAVVLPKALAYASVAGLPVE
VGLYTAFVPMVIYALFGTSRPLSVSTSATLAILTAAALAQAAPGGDTATLMRATAMLTLL
VGGILALAALLRLGFVANFISDPVLTGFKAGIAVVIVLDQLPKLLGIHPEKGSFFHNVAA
VAMGVPHASGWTVGVGVTTIVVLVALERLYPRAPAPLVAVACGIGAVVLLGLPERGVGVV
GHIPTGLPSVVMPDLSLAGVLWKDAVGIALMSFTETIAAGRAFAVSGEPTPQPNRELFAT
GLGNAAGALLGSMPAGGGTSQTAVNRLAGARSQGAELVTATVTLGTMLLLAPLIGLMPHA
TLAAVVIVYSIGLFSPADFRAILRIRRTEFVWAIVALAGVVLLGTLQGILVAIVVSLVAL
AHQVADPPVYLLRRKPGTNVFRPVSAEHPDDESFPGLLVLRIEGRVFFANAGHIGEKLRP
LIDDAQPQVVVLDMSAVFDIEYTALKMLIEAEKKQRERGVFIWLAHLNPGVLAAVQLSPL
GATLGRERMYFNLEEALAAWQALRSRDTANRAPR