Protein Info for QEN71_RS09195 in Paraburkholderia sabiae LMG 24235

Annotation: MlaD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details PF02470: MlaD" amino acids 46 to 120 (75 residues), 41.7 bits, see alignment E=5.7e-15 amino acids 161 to 221 (61 residues), 43.8 bits, see alignment E=1.3e-15 amino acids 299 to 395 (97 residues), 41.4 bits, see alignment E=6.8e-15

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 93% identity to bph:Bphy_5506)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>QEN71_RS09195 MlaD family protein (Paraburkholderia sabiae LMG 24235)
MSRPPELPEAVAVPRKRWRIQWIWIVPVVAVLVGIWLAVQAVLSQGPTITISFKTGEGLE
AGKTKIKFKDVDIGVVKKVALSDDYKRVIATAELTRDATDMLVGDTRFWVVRPRIAGGTV
SGISTLLSGAFIGMDIGKAKDERRDYTGLEVPPVFASDVPGREFVLKATDLGSVDVGTPV
YFRRLQVGQVTSFDLDKDGGGVTLHVFINAPYDRYVNTDSRFWQAGGIDVTLGTEGVQIN
TQSVVSILVGGLAFETPAKSLNQPEAESKATFTLFATRDDAMKLHESIVEKFAFDFQGSV
RGLVVGAPVDFRGITVGEVAAIYTRFDPVTKRISIPVEVNLFPERFTSRYATEPKGGRLG
DNPHALADFLVERGLRGQLKTGSLITGQLYIALDFFPDAPKAHVDWNRTPPEIPTTPSGL
QSLQESLNRIIARIDGLPLEQIGKNAQQTLASTSLLMRNLNTQVVPQAKNALTAAQATLN
SANTALQPDSALQQDTSDAVRELARTAASFRALSDYLQRHPEALLRGKTEDAK