Protein Info for QEN71_RS08485 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF13439: Glyco_transf_4" amino acids 15 to 156 (142 residues), 86.8 bits, see alignment E=4.5e-28 PF13579: Glyco_trans_4_4" amino acids 16 to 156 (141 residues), 62.8 bits, see alignment E=1.3e-20 PF13477: Glyco_trans_4_2" amino acids 27 to 115 (89 residues), 35.1 bits, see alignment E=3.8e-12 PF00534: Glycos_transf_1" amino acids 174 to 328 (155 residues), 115.4 bits, see alignment E=5.2e-37 PF13692: Glyco_trans_1_4" amino acids 177 to 316 (140 residues), 104.9 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: None (inferred from 56% identity to bug:BC1001_1911)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>QEN71_RS08485 glycosyltransferase family 4 protein (Paraburkholderia sabiae LMG 24235)
MRIVHLANHIRNSGNGIVNMMVDLACSQANAGNEVIVATSGGEFDELLNRHGVRTFQLPQ
SSRLWRIFSMIRAFRELARECQPDVVHAHMVTGILIGRFAAVKRNYVLVATVHNVFQRSA
SLMRLGDRVVCVTKDVAKSMRNRGISRSKIEVVRNGTIGSPRRSQMELPSAETLERPCIV
TVAGMYERKGIRDLILAFSLVNGRFPESNLYLVGDGPDRPAMEALVHDLKLEERVRFTGF
ISDPRSYLRNSDVFVLASHNESGALALVEAREAGCAIIATDVDGNPEMLDFGRAGVLVPV
KNPETLADEICMMLHNHELRESYRQRSRIGINEFRVENVCEQYLSIYRRAIICLGKRSGK
RD