Protein Info for QEN71_RS08465 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF13439: Glyco_transf_4" amino acids 26 to 188 (163 residues), 87.2 bits, see alignment E=3.3e-28 PF13579: Glyco_trans_4_4" amino acids 26 to 182 (157 residues), 62.2 bits, see alignment E=1.9e-20 PF00534: Glycos_transf_1" amino acids 198 to 367 (170 residues), 121 bits, see alignment E=1e-38 PF20706: GT4-conflict" amino acids 204 to 325 (122 residues), 36.8 bits, see alignment E=5.9e-13 PF13692: Glyco_trans_1_4" amino acids 209 to 351 (143 residues), 98.7 bits, see alignment E=9.3e-32

Best Hits

KEGG orthology group: None (inferred from 90% identity to bph:Bphy_1066)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>QEN71_RS08465 glycosyltransferase family 4 protein (Paraburkholderia sabiae LMG 24235)
MEKGTVRSRSIKSLQIGMHWFPERAGGLDRMYYSLIGALPGAGVEVRGVVAGSERVAHDT
NGAINGFGSAAQSLPLRLMAARRALRREIREQHPDVISSHFALYTFPGLDVTRGIPQISH
FHGPWSEESHVEGPGSLGRRIKRYLERTVYVRSSRLIVLSDAFGKILTSRYGIPADRVRV
VPGCVNVDQFNLPLMQNEARLRLQLPLGRPIVLAVRRLVRRMGLEDLIDAVKIVKRRNPD
VLLLIAGKGRLHEELQQRIDDAGLGDNVKLLGFVPDEYLAALYRAADISVVPTVALEGFG
LITVESLASGTPVLVTPVGGLPEAVAGLSQDLVLPSTGADAIADGLGQVLDGSLRLPDAD
ACSRYARVNFDNTVIAEKVAKVYEEAVGAY