Protein Info for QEN71_RS07240 in Paraburkholderia sabiae LMG 24235

Annotation: YeiH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 104 to 106 (3 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details TIGR00698: conserved hypothetical protein" amino acids 21 to 358 (338 residues), 233.6 bits, see alignment E=1.9e-73 PF03601: Cons_hypoth698" amino acids 23 to 337 (315 residues), 282.9 bits, see alignment E=1.2e-88

Best Hits

Swiss-Prot: 62% identical to Y3732_BORPA: UPF0324 membrane protein BPP3732 (BPP3732) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_1256)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>QEN71_RS07240 YeiH family protein (Paraburkholderia sabiae LMG 24235)
MSTAHTHAVPAAAPSSTRGQINGILFVALFAAAVTRIAAIPSIANLGISPLIVGIVGGMI
YGNALKDGMPDSWAAGVNFSARKLLRIAVAFFGLRVSIQEIAQVGLPGLTESLLIVVSTL
VIGTWAGMKLMKLDRDSALLTAAGSAICGAAAVLAFESTLQSKPHKSAMAVGSVVLFGTL
SMFLYPALLRAGIIHLDTTGVGLFFGGTIHEVAQVVGAASNVSPEATHIATIVKMTRVML
LVPVLLIVGFWVNRSARQAMAKGTHDATHAPRKLAVPWFALGFLACVAVNSLHILPEAAT
NTVNMLDTFALTMAMTALGIETRLSQIRDAGPRALTTGLILYVWLFAGGLGITWLVQHLF
G