Protein Info for QEN71_RS07115 in Paraburkholderia sabiae LMG 24235

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 301 to 325 (25 residues), see Phobius details amino acids 345 to 363 (19 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 27 to 399 (373 residues), 334.8 bits, see alignment E=4.3e-104 PF01566: Nramp" amino acids 47 to 405 (359 residues), 402.9 bits, see alignment E=6.3e-125

Best Hits

Swiss-Prot: 50% identical to MNTH_BRADU: Divalent metal cation transporter MntH (mntH) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03322, manganese transport protein (inferred from 90% identity to bph:Bphy_1280)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>QEN71_RS07115 Nramp family divalent metal transporter (Paraburkholderia sabiae LMG 24235)
MNTNPFISSASRRRRRRGTGSPRPQNWISFVGAGALVAVGYMDPGNWATALAGGASYGYT
LLSVVVASSLMAMLLQWVSSRLGVVTGRDLAQHCRERTSRRMTLFLWVTSEIAIIACDVA
EVVGSAVALQLLFGVSLTAGVLMSAFGTFAMLALQRHGRRTLETVVVALILFVGLCFVIE
LALARPDWRAALTGAAPSAELLRNAGMVWLAAGILGATVMPHNLYLHSALVKTHAHSDSA
ADIGDALRGVNFGTFSALSLAFVINAALLIVSAAVFHASGHRNVTDLADAHRLIAPIVGS
HWAAILFAAALLACGLSATVTGTLAGQVVMEGFLQIRLPRWQRALLTRSLAIGPALVAVG
LFGPNGSAQLLVASQVVLSLQLPLAVVPLIRFASDARLMHDWRVRGVPLVLAWACAAGII
ALNGALIWETATG