Protein Info for QEN71_RS07105 in Paraburkholderia sabiae LMG 24235

Annotation: OmpW family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13505: OMP_b-brl" amino acids 16 to 214 (199 residues), 41.9 bits, see alignment E=1.3e-14 PF03922: OmpW" amino acids 37 to 214 (178 residues), 154.4 bits, see alignment E=3.5e-49

Best Hits

Swiss-Prot: 35% identical to OMPW_ECOLI: Outer membrane protein W (ompW) from Escherichia coli (strain K12)

KEGG orthology group: K07275, outer membrane protein (inferred from 93% identity to bph:Bphy_1282)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>QEN71_RS07105 OmpW family outer membrane protein (Paraburkholderia sabiae LMG 24235)
MNTTIRSIAAALCMAGLALTSAHAFAADSDPTSGIHAGDVLVRLRAISIVPQTRTSDTLS
TLNVDVNNATVPELDFTYMIRDNIGVELILATSRHQLTSSLGGLGGVNVLPPTLLLQYHF
NHQGQVRPYVGAGVNYTYFYNNGLHAGDQQISVKRSSFGPALQMGVDVQLTKSVFANVDV
KKIWMKTDASLNGASLGTLHIDPLIVGVGVGMKF