Protein Info for QEN71_RS06550 in Paraburkholderia sabiae LMG 24235

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 199 (195 residues), 246.7 bits, E=1.1e-77
• PF00117: GATase
  • amino acids 6 to 195 (190 residues), 138.5 bits, E=5.7e-44
• PF07722: Peptidase_C26
  • amino acids 69 to 178 (110 residues), 37.9 bits, E=4.2e-13
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 208 to 527 (320 residues), 488.8 bits, E=6.8e-151
• PF02540: NAD_synthase
  • amino acids 210 to 291 (82 residues), 35.4 bits, E=1.6e-12
• PF03054: tRNA_Me_trans
  • amino acids 224 to 290 (67 residues), 23.3 bits, E=1.1e-08
• PF00958: GMP_synt_C
  • amino acids 440 to 526 (87 residues), 140.1 bits, E=4.9e-45

Best Hits

Swiss-Prot: 99% identical to GUAA_PARP8: GMP synthase [glutamine-hydrolyzing] (guaA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 99% identity to bph:Bphy_1312)

MetaCyc: 67% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (527 amino acids)

>QEN71_RS06550 glutamine-hydrolyzing GMP synthase (Paraburkholderia sabiae LMG 24235)
MHDKILILDFGSQVTQLIARRIREAHVLSEIHPHDVSDEFIREFKPTGIILSGGPNSVTE
TDTPRAPQAVFEAGVPVLGICYGMQTMAEQLGGKVDSGHLREFGYAEVRARNHTSFLDGI
QDFATPEGHGMLKVWMSHGDKVLEMPAGFQLMASTESCPIAAMADEARHFYGLQWHPEVT
HTVQGRAMLERFVLKICGAKPDWEMGNYIDEAVENIRKQVGDEHVILGLSGGVDSSVAAA
LLHRAIGDQLTCVFVDHGLLRLNEAEQVMSMFADNLGVKVIHVDASEAFMSKLKGVTDPE
AKRKIIGAEFVEVFQTEAGKLTDAKWLAQGTIYPDVIESAGKGKKAAHTIKSHHNVGGLP
ETLNLKLLEPLRELFKDEVRELGVKLGLPPSMVYRHPFPGPGLGVRILGEVKREYADLLR
RADAIFIESLRTFIDKETGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTL
DFMTAHWAHLPHDLLGHVSNRIINEVRGINRVVYDISGKPPATIEWE