Protein Info for QEN71_RS06540 in Paraburkholderia sabiae LMG 24235

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 7 to 454 (448 residues), 632.3 bits, see alignment E=2.4e-194 PF00478: IMPDH" amino acids 7 to 472 (466 residues), 552 bits, see alignment E=1.3e-169 PF00571: CBS" amino acids 93 to 138 (46 residues), 39.8 bits, see alignment 1.2e-13 amino acids 147 to 201 (55 residues), 33.7 bits, see alignment 9.4e-12 PF03060: NMO" amino acids 203 to 370 (168 residues), 41 bits, see alignment E=4.1e-14 PF01070: FMN_dh" amino acids 257 to 362 (106 residues), 36.5 bits, see alignment E=7.4e-13

Best Hits

Swiss-Prot: 64% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 99% identity to bph:Bphy_1314)

MetaCyc: 61% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>QEN71_RS06540 IMP dehydrogenase (Paraburkholderia sabiae LMG 24235)
MRLIQKALTFDDVLLVPAFSDVLPRDTSLKTRLTRNISLNMPLVSAAMDTVTEARLAIAM
AQMGGVGIIHKNLTPAEQAREVAKVKRFESGVVRDPITVPPQMKVSDVIALSRQHGISGF
PVVEGAQLIGIVTNRDLRFETRLDEPVRTIMTPRERLVTVKEGTPLAEAKALMHSHRLER
VLVVNDAFELRGLMTVKDITKQTEHPDACKDEHGKLRAGAAVGVGADNEERVSLLVQAGV
DVIVVDTAHGHSKGVLERVQWVKKNFPHVEVIGGNIATADAAKALVEYGADGVKVGIGPG
SICTTRIVAGVGVPQISAIANVSAALKGTGVPVIADGGVRFSGDVSKALAAGANAVMMGS
MFAGTEEAPGDVFLYQGRQYKSYRGMGSVGAMKDGAADRYFQDNSANIDKLVPEGIEGRV
AYKGSVGAILFQLIGGVRASMGYCGCRTIDEMHEKAAFVEITAAGMRESHVHDVQITKEA
PNYHVD