Protein Info for QEN71_RS06085 in Paraburkholderia sabiae LMG 24235

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 TIGR01070: DNA mismatch repair protein MutS" amino acids 14 to 882 (869 residues), 1052.5 bits, see alignment E=0 PF01624: MutS_I" amino acids 15 to 126 (112 residues), 146.2 bits, see alignment E=1.2e-46 PF05188: MutS_II" amino acids 136 to 269 (134 residues), 67.1 bits, see alignment E=5.3e-22 PF05192: MutS_III" amino acids 286 to 580 (295 residues), 155.5 bits, see alignment E=5.6e-49 PF05190: MutS_IV" amino acids 449 to 540 (92 residues), 109.6 bits, see alignment E=1.9e-35 PF00488: MutS_V" amino acids 630 to 816 (187 residues), 280.6 bits, see alignment E=1.8e-87

Best Hits

Swiss-Prot: 96% identical to MUTS_PARP8: DNA mismatch repair protein MutS (mutS) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 96% identity to bph:Bphy_1399)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (892 amino acids)

>QEN71_RS06085 DNA mismatch repair protein MutS (Paraburkholderia sabiae LMG 24235)
MGTQTAAASDNTQHTPMMQQYLRIKGEHPGTLVFYRMGDFYELFFDDAEKAARLLDLTLT
RRGASGGNPIKMAGVPHHAVEQYLAKLVKLGESVAICEQIGDPATSKGPVERKVVRVVTP
GTLTDAALLSDKSDTYLLAVCAGHNRRGLVTTVGLAWLNLASGALRLAEVAPDQVAAALE
RIRPAEILVADAPSSGDSNAWSVPTGFGATTRVPVWHFDIASGTQRLCDQLEVAGLDGFG
AHSLSCACGAAGALLLYAAATQGQQLRHVRSLKVEYESEYIGLDPSTRRNLELTETLRGT
DSPTLCSLLDTCCTTMGSRLLRHWLHHPPRDAAFAQARQQAIGALLDAPPEASLDALRGA
LRQISDIERITGRLALLSARPRDLSSLRDTFVALPELRAQLTALTAAADSLARIDASLEP
PADCVDLLKRAVAQEPAAMIRDGGVIARGYDADLDELRDISENCGQFLIDLETRERARTG
IGNLRVEYNKVHGFYIEVTRGQTDKVPDDYRRRQTLKNAERYITPELKTFEDKALSAQER
ALAREKALYDALLQSLLPFIADCQRVASALAELDLLAAFAERARALDWVAPSFSPTGGID
IEQGRHPVVEAQVEQFIANDCALNPERKLLLITGPNMGGKSTFMRQTALIALMAYVGSYV
PARRASFGPIDRIFTRIGAADDLAGGRSTFMVEMTEAAAILNDATPQSLVLMDEIGRGTS
TFDGLALAWAIARHLLAHNGCHTLFATHYFELTQLPAEFPHAANVHLSAVEHGHGIVFLH
AVNEGPANQSYGLQVAQLAGVPNAVIRAARKHLAYLEQQSAAQPAPQLDLFAAPVAMLED
ADDEPAAPALDPATLALVERLREIDPNDLRPRDALDLLFELHELAKSPDASR