Protein Info for QEN71_RS06030 in Paraburkholderia sabiae LMG 24235

Annotation: adenylosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00184: adenylosuccinate synthase
  • amino acids 15 to 446 (432 residues), 575 bits, E=4.7e-177
• PF00709: Adenylsucc_synt
  • amino acids 15 to 440 (426 residues), 599.2 bits, E=1.9e-184

Best Hits

Swiss-Prot: 98% identical to PURA_PARP8: Adenylosuccinate synthetase (purA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 98% identity to bph:Bphy_1409)

MetaCyc: 61% identical to adenylosuccinate synthetase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Protein Sequence (448 amino acids)

>QEN71_RS06030 adenylosuccinate synthase (Paraburkholderia sabiae LMG 24235)
MSASAVNVNPGRNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQGGHNAGHTLIIGGKKT
ILRLIPSGIMRPGVACYIGNGVVLSPEALFKEIEELESAGVDVQKRLFISEATTLILPYH
VAIDQAREARSGAGKIGTTGRGIGPAYEDKVARRGLRVQDLFQPEVFAERLRANLDFHNF
VLTQYLGAPAVDYQQTLDMMLGYADRLKPMIADVSRRLYDENHAGNNLLFEGAQGTLLDI
DHGTYPFVTSSNCVAGAATSGAGIGPQKLDYILGITKAYCTRVGSGPFPSELYDADNANR
QEEVGLTLAKVGKEFGSVTGRPRRTGWLDAAALRRAIQINGVSGLCITKLDVLDGLDEVK
LCVGYTVDGKDADILPRGAYEVSRCEPVYETFGGWKESTVGIKEWSKLPANAQAYLTRVQ
EVAGVPIDMVSTGPDRDETILLRHPFKV