Protein Info for QEN71_RS05995 in Paraburkholderia sabiae LMG 24235

Annotation: ribosome biogenesis GTPase Der

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 436 (434 residues), 564.9 bits, see alignment E=1.9e-173 TIGR00231: small GTP-binding protein domain" amino acids 4 to 158 (155 residues), 65.7 bits, see alignment E=6.6e-22 amino acids 180 to 341 (162 residues), 91.2 bits, see alignment E=9e-30 PF02421: FeoB_N" amino acids 5 to 137 (133 residues), 42.7 bits, see alignment E=2e-14 amino acids 181 to 343 (163 residues), 43.4 bits, see alignment E=1.2e-14 PF01926: MMR_HSR1" amino acids 5 to 121 (117 residues), 98.4 bits, see alignment E=1.3e-31 amino acids 182 to 300 (119 residues), 93.7 bits, see alignment E=3.7e-30 PF00009: GTP_EFTU" amino acids 182 to 349 (168 residues), 36.9 bits, see alignment E=1.3e-12 PF14714: KH_dom-like" amino acids 356 to 436 (81 residues), 91.1 bits, see alignment E=2e-29

Best Hits

Swiss-Prot: 99% identical to DER_PARP8: GTPase Der (der) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03977, GTP-binding protein (inferred from 99% identity to bph:Bphy_1416)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>QEN71_RS05995 ribosome biogenesis GTPase Der (Paraburkholderia sabiae LMG 24235)
MKPVIALVGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGGERPYLVVDTGG
FEPVAKDGILFEMARQTRQAVEESDVIVFIVDGRNGLAPQDKSIADYLRKTGRPIFLVVN
KAEGMKYTNVAADFYELGLGDPRAISAAHGDGVTEMINEALDVAYAGQPEESEEEKAQHG
IKIAIVGRPNVGKSTLVNTLIGEDRVIAFDMPGTTRDSIYVDFERQGKKYTLIDTAGLRK
RGKVFEAIEKFSVVKTLQSISDANVVILLLDARQDISEQDAHIAGFVVEQGRALVVGVNK
WDGLDPHVRERTKNDLQRKLKFLEFAKFHFISAAEKTGIGPLMRSVEDAYKAAMSKLPTP
KLTRALIDAVEFQQPRRRGPVRPKLRYAHQGGQNPPIIVIHGNALDAITDTYRRYLENRF
RETFALTGTPLRIEFRSSTNPYADKD