Protein Info for QEN71_RS05760 in Paraburkholderia sabiae LMG 24235

Annotation: lactate utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 401 to 422 (22 residues), see Phobius details PF02589: LUD_dom" amino acids 67 to 292 (226 residues), 161.7 bits, see alignment E=6.2e-51 PF13183: Fer4_8" amino acids 306 to 374 (69 residues), 48.5 bits, see alignment E=3.8e-16 PF13534: Fer4_17" amino acids 309 to 374 (66 residues), 28.5 bits, see alignment E=6.3e-10 PF11870: LutB_C" amino acids 392 to 464 (73 residues), 37.6 bits, see alignment E=8.2e-13

Best Hits

Swiss-Prot: 45% identical to LUTB_BACP2: Lactate utilization protein B (lutB) from Bacillus pumilus (strain SAFR-032)

KEGG orthology group: None (inferred from 97% identity to bph:Bphy_1463)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>QEN71_RS05760 lactate utilization protein B (Paraburkholderia sabiae LMG 24235)
MQVQTMQFKARAGQKLADQRLQQNLTKLSTKFVSARASAMTAIDFHATRDALKERRNRAL
QNLDVWLETFEREATRRGVTVLFAETTQDAAKLVADIARKHDVKKVIKTKSMVSEEMRLN
EVLGQMGVQSIETDLGEYILQINDNEPPSHIIAPVVHKDKEEIADLFAKTHNKPRLTEIP
EMTREAREMLRPHFMTADMGVTGGNFVIAETGSVALVTNEGNEGMCTVMPRVHVAVTGIE
KVLPTLEDLATAMRLLPRSATGQDVSNYFSVLTGPRGADDQDGPEHMYVVLVDGGRTGLI
GGDFQEMLRCIRCGACMNHCPVYQKVGGHTYGWVYPGPMGSVLTPSYVGIEKALDLPQAA
TLCGECNSVCPVGIPLSDLLRKLRERQMERHLRPWQERFGLAVWGYLAMHPAAYGLFTKV
AVRILERMGGNRKSIAKLPLGGGWTNTREMPAPVGRTFRELYAASKTHIG