Protein Info for QEN71_RS05525 in Paraburkholderia sabiae LMG 24235

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF00072: Response_reg" amino acids 4 to 120 (117 residues), 89.5 bits, see alignment E=1.6e-29 PF00196: GerE" amino acids 152 to 207 (56 residues), 50.3 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 32% identical to LIAR_BACSU: Transcriptional regulatory protein LiaR (liaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_1508)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>QEN71_RS05525 response regulator transcription factor (Paraburkholderia sabiae LMG 24235)
MIRVLIADDHAIVRGGFRQFVADEPDMCVAAEAATGDETIRLVREQPDGEPFDVVLLDIA
MPDKNGIDTLRVIRQMRPAQNVLILSGYPESQYAINLLRAGANGYLNKDCEPDEIVRAIR
SVARGHRYLSEAIADTLANSLDKPAASHPHEQLSEREFQIFCKLASGQIPTDIADELHLS
VKTVSTYRARVLEKMHMTNNADITYYAIKNGLIE