Protein Info for QEN71_RS05410 in Paraburkholderia sabiae LMG 24235

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 37 to 256 (220 residues), 221.6 bits, see alignment E=9.5e-70 PF12974: Phosphonate-bd" amino acids 65 to 251 (187 residues), 34 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 96% identity to bph:Bphy_1531)

Predicted SEED Role

"Cystine ABC transporter, periplasmic cystine-binding protein FliY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>QEN71_RS05410 amino acid ABC transporter substrate-binding protein (Paraburkholderia sabiae LMG 24235)
MKSIRSLLLIGLLQVATATAAFAADDLAKIKSAGAFKIGTEGTYAPFTFHDASNQLTGFD
VEIGRAIAKKLGVKAEFVEGKWDGLIAGLDANRYDAVINEVAVTDARKQKYDFSEPYIVS
HAALIVRSDNSTIKGFDDLKGKKSANTLTSNFGKIAAAHGAEVVPVQGFNESIDLLTSGR
VDATVNDSLSFLDFKKHKPDAKVKIAAIDTSSDSSDHSAVLIRKGNPELQAAINKALAEL
KADGTYAKISEKYFGKDVSK