Protein Info for QEN71_RS05365 in Paraburkholderia sabiae LMG 24235

Annotation: 2,3-epoxybenzoyl-CoA dihydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03222: benzoyl-CoA-dihydrodiol lyase
  • amino acids 11 to 556 (546 residues), 1019.5 bits, E=0
• PF00378: ECH_1
  • amino acids 52 to 242 (191 residues), 85.4 bits, E=4.1e-28

Best Hits

Swiss-Prot: 69% identical to BOXC_AZOEV: Benzoyl-CoA-dihydrodiol lyase (boxC) from Azoarcus evansii

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 93% identity to bph:Bphy_1540)

MetaCyc: 69% identical to benzoyl-CoA-dihydrodiol lyase monomer (Aromatoleum evansii)
RXN-11054 [EC: 4.1.2.44]

Predicted SEED Role

"Benzoyl-CoA-dihydrodiol lyase (EC 4.1.2.44)" (EC 4.1.2.44)

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• adipate degradation (5/5 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• phenylacetate degradation I (aerobic) (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• superpathway of phenylethylamine degradation (8/11 steps found)
• benzoyl-CoA degradation I (aerobic) (5/7 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• 3-phenylpropanoate degradation (6/10 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (5/9 steps found)
• valproate β-oxidation (5/9 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.1.2.44 or 4.2.1.17

Protein Sequence (556 amino acids)

>QEN71_RS05365 2,3-epoxybenzoyl-CoA dihydrolase (Paraburkholderia sabiae LMG 24235)
MSPADTAAAQVDYRTDPSQYKHWKLSFNGPVATLGIDIAEDGGIRDGYKLKLNSYDLGVD
IELHDALQRIRFEHPEVRSVVLTSLKDRVFCSGANIFMLGLSSHAWKVNFCKFTNETRNG
IEDSSRNSGLKFLAAVNGSCAGGGYELALACDEIYLVDDRSSSVALPEVPLLGVLPGTGG
LTRVTDKRKVRHDRADIFCTVVEGIRGARAKEWRLVDEVVKPNQFEQAIAARALELAQQS
DRPADAQGATLTRIERTDREDGLTYATLDVTIDRAKRTATFTAKAPTTQQPSGIDGIVAK
GANWWPLQFARELDDAILSMRTNELDIGTWILKTEGDARAVLAADATLLQHKDHWFVRET
IGLLRRTLARLDVSSRSLFALIEPGSCFAGTFAEFAFAADRTYMAALPANEDEEPAITLS
EVNFGLYPMVTHQSRLARRFYEETEPLDAVRATIGEPVKAVEAERLGLVTASLDDIDWAD
EIRIALEERAAMSPDALTGMEANLRFNGRETMETRIFGRLTAWQNWIFNRPNAVGEKGAL
KVYGKGSKAQFDVSRV