Protein Info for QEN71_RS05350 in Paraburkholderia sabiae LMG 24235

Annotation: benzoate-CoA ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 88 to 113 (26 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details TIGR02262: benzoate-CoA ligase family" amino acids 22 to 528 (507 residues), 759.3 bits, see alignment E=1e-232 PF00501: AMP-binding" amino acids 35 to 393 (359 residues), 276.2 bits, see alignment E=4e-86 PF13193: AMP-binding_C" amino acids 443 to 520 (78 residues), 70.6 bits, see alignment E=1.7e-23

Best Hits

KEGG orthology group: K04110, benzoate-CoA ligase [EC: 6.2.1.25] (inferred from 93% identity to bph:Bphy_1543)

Predicted SEED Role

"Benzoate-CoA ligase (EC 6.2.1.25)" in subsystem Benzoate transport and degradation cluster (EC 6.2.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>QEN71_RS05350 benzoate-CoA ligase family protein (Paraburkholderia sabiae LMG 24235)
MQALLETPPGEPAPKVEAPPAQFNFASHLFRLNDTRADKAAYIDDAGVTSFAQLEDRARR
FASALRAIGVHAEERILLVMLDTAELPVAFLGALYAGVVPVVANTLLTAADYLYMLTHSH
ARAVIASGALLPAVEQAMSEAEHDGCLLIVSQPVHLDPPPSHVLNQLIDGAEPLLKPNAC
SGDDIAFWLYSSGSTGKPKGTVHTHANLYWTAELYAKPILGITERDVVFSAAKLFFAYGL
GNALTFPLSVGATAVLMAERPTPDAIFRRLVEHRPTIFYGVPTLYANMLVSPNLPPRGQV
AMRVCTSAGEALPREIGERFTAHFGCEILDGIGSTEMLHIFLSNRAGEVEYGTTGRPVPG
YEVELRDEAGHPVPDGEVGDLFIKGPSAALMYWSNREKSRATFLGEWIRSGDKYCRLPNG
CYQYAGRSDDMLKVSGQYVSPVEVEMVLVQHTAVLEAAVVGIDHGGLVKTRAFVVLKQTA
DACDALADELKSFVKGKLAPHKYPRDIVFVDDLPKTATGKIQRFKLREQLNS