Protein Info for QEN71_RS05045 in Paraburkholderia sabiae LMG 24235

Annotation: 5-deoxy-glucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04962: KduI
  • amino acids 4 to 261 (258 residues), 354.5 bits, E=1.7e-110
• TIGR04378: 5-deoxy-glucuronate isomerase
  • amino acids 16 to 262 (247 residues), 326.4 bits, E=6.1e-102

Best Hits

Swiss-Prot: 52% identical to IOLB_GEOTN: 5-deoxy-glucuronate isomerase (iolB) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 95% identity to bph:Bphy_1603)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

• myo-inositol degradation I (6/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (6/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Protein Sequence (268 amino acids)

>QEN71_RS05045 5-deoxy-glucuronate isomerase (Paraburkholderia sabiae LMG 24235)
MSLLVKATREGQTIARVTPESAGWRYVGFAAYRMEPNEVVHVLEASREVCIVVMAGAVDI
ETDAQTWSALGSRDSVFEDSAPVALYLPPNTRAIVRANRFAEVGVASAPAKGEYPARLIE
PSQMKRSVRGKGANTRFVCDILPQTEPAESLLVVEVRTPGGHSSSYPPHKHDTENVPAES
SLEETYYHRLSPTQGFAFQRVYTDSRDIDESLAVEDHDVVMVPRGYHPVVVPYGYDSYYL
NVMAGPARTWHFKNDPKHEWIIERDSKS