Protein Info for QEN71_RS04545 in Paraburkholderia sabiae LMG 24235

Annotation: beta-ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 7 to 329 (323 residues), 408.7 bits, see alignment E=8.2e-127 PF00108: Thiolase_N" amino acids 45 to 156 (112 residues), 40.2 bits, see alignment E=4.2e-14 PF08545: ACP_syn_III" amino acids 117 to 194 (78 residues), 110.7 bits, see alignment E=3.8e-36 PF08541: ACP_syn_III_C" amino acids 240 to 329 (90 residues), 128.1 bits, see alignment E=1.7e-41

Best Hits

Swiss-Prot: 97% identical to FABH_PARP8: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 97% identity to bph:Bphy_0828)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>QEN71_RS04545 beta-ketoacyl-ACP synthase III (Paraburkholderia sabiae LMG 24235)
MAQSTTYSRVLGTGSYLPSNRVSNQELADRLAKQGVETSDEWIVARTGIHARHFADPDVT
TSDLSLIASQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNNGAAFDVQ
AVCSGFAYAVATADSFIRSGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVILQAS
DEPGVLASALHADGSHSNILCTPGNVNGGIVQGSAFLHMDGQAVFKLAVNVLEKVAVEAL
QKADLQPEQVDWLIPHQANIRIMQSTCRKLGLPQERMVVTVHEHGNTSAASIPLALDVAV
RDGRIQRGHNVLIEGVGGGFTWGASVIRY