Protein Info for QEN71_RS04490 in Paraburkholderia sabiae LMG 24235

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 28 to 370 (343 residues), 383 bits, see alignment E=5.3e-119 PF04055: Radical_SAM" amino acids 41 to 209 (169 residues), 115.4 bits, see alignment E=4.9e-37 PF13353: Fer4_12" amino acids 46 to 152 (107 residues), 24.6 bits, see alignment E=4.2e-09 PF06463: Mob_synth_C" amino acids 218 to 344 (127 residues), 122.1 bits, see alignment E=2.2e-39

Best Hits

Swiss-Prot: 69% identical to MOAA_RALSO: GTP 3',8-cyclase (moaA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 95% identity to bph:Bphy_0817)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>QEN71_RS04490 GTP 3',8-cyclase MoaA (Paraburkholderia sabiae LMG 24235)
MSRRIIPVADVSAVPDVAGPARIPRGELTDTLSRPLRDLRISVTDRCNFRCVYCMPRAVF
DKDYPFLPHSALLTFEEIERIAAIFVAHGVEKIRLTGGEPLLRKNLEFLIERLARMTTAT
GKPLDLTLTTNGSLLARKAQSLKDAGLNRVTVSLDALDDVLFRRMNDADFAVRDVLEGIE
VAQSVGLAPLKVNMVVKRGTNDSEIVPMAAHFKGSGVVLRFIEYMDVGTSNGWNMTEVLP
SADVVARISEHFPLLPLEAHSAAETAQRWGYADGSGEIGVISSVTRAFCGDCTRARLSTE
GKVYLCLFASSGHDLRALVRNGTSDAGIATAVANMWHARGDRYSQLRGSASAASRTTSEE
RRVEMSYIGG