Protein Info for QEN71_RS04485 in Paraburkholderia sabiae LMG 24235

Annotation: molybdenum cofactor guanylyltransferase MobA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR02665: molybdenum cofactor guanylyltransferase" amino acids 8 to 199 (192 residues), 227.5 bits, see alignment E=6.7e-72 PF12804: NTP_transf_3" amino acids 10 to 177 (168 residues), 122.5 bits, see alignment E=9.7e-40

Best Hits

Swiss-Prot: 68% identical to MOBA_BURCC: Molybdenum cofactor guanylyltransferase (mobA) from Burkholderia cenocepacia (strain MC0-3)

KEGG orthology group: K03752, molybdopterin-guanine dinucleotide biosynthesis protein A (inferred from 91% identity to bph:Bphy_0816)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>QEN71_RS04485 molybdenum cofactor guanylyltransferase MobA (Paraburkholderia sabiae LMG 24235)
MTVSRDDITGLLLAGGRGMRMGGADKGLQMLNGEPLALHVMRRLAPQAGSLLISANRHAE
RYAELGAPFHATVIADTLPDFPGPLAGLLAGLRAARTPFVLSAPCDTPGFPADLADRLVA
ALDEHQANIATVTTTDTEGNTSIHPVFALVRTSLADDLEGFLQAGERKVRTWYARHRAVE
VAFPDERTFYNINSLQELADFERR