Protein Info for QEN71_RS04455 in Paraburkholderia sabiae LMG 24235

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 195 to 223 (29 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 326 to 355 (30 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 445 to 467 (23 residues), see Phobius details PF16980: CitMHS_2" amino acids 28 to 468 (441 residues), 656.4 bits, see alignment E=1e-201

Best Hits

KEGG orthology group: None (inferred from 89% identity to bph:Bphy_0810)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>QEN71_RS04455 sodium:proton antiporter (Paraburkholderia sabiae LMG 24235)
MPGTRFALLFALTCWPFAASAASLDGAALSVWWGAPFAGILLSIAVFPLVAPKLWHHHFG
KISAAWAMLFLVPFAFAFGAPMAFGTLIHAMLEEYVPFIVLLTALYTVAGGICVTGNLHG
SPRLNTALLALGTALASIMGTTGAAMLLIRPLLRANDNRKHVVHVVVFFIFLVANAGGSL
SPLGDPPLFLGFLNGVGFFWTTVHLALPMLFICVVLLAAFYALDSFYFRHREEVLPVDPS
PDTQGVGVTGKINFVLLALVIGLVLMSGLWKPGITFDVAGTHVALQNIVRDVALVAVTLL
SLAVTPHAAREGNAFNWAPIEEVAKLFAGIFVTIAPVIVMLRAGEAGAFSGIVHLVNDTA
GQPRDEMYFWATGVLSSFLDNAPTYLVFFNLAGGDAQTLMNTGASTLAAISAGAVFMGAN
SYIGNAPNFMVKAIAESRGVQMPSFFGYLAWSGVVLVPLFIATSWIFF