Protein Info for QEN71_RS04260 in Paraburkholderia sabiae LMG 24235

Annotation: molybdopterin adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00177: molybdenum cofactor synthesis domain
  • amino acids 14 to 158 (145 residues), 124.4 bits, E=1.9e-40
• PF00994: MoCF_biosynth
  • amino acids 16 to 157 (142 residues), 90.5 bits, E=4.2e-30

Best Hits

Swiss-Prot: 73% identical to MOG_ECO57: Molybdopterin adenylyltransferase (mog) from Escherichia coli O157:H7

KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 95% identity to bph:Bphy_0779)

MetaCyc: 73% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]

Predicted SEED Role

"Molybdopterin biosynthesis molybdochelatase MogA"

MetaCyc Pathways

• molybdenum cofactor biosynthesis (2/3 steps found)
• bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.75

Protein Sequence (208 amino acids)

>QEN71_RS04260 molybdopterin adenylyltransferase (Paraburkholderia sabiae LMG 24235)
MTIPTRNHPDELIVGLVSISDRASTGVYEDKGIPSLQEWLGAALTSPFRTETRLIQDDAQ
TITKTLIELVDEAGCDLVLTTGGTGPARRDVTPEATLAAGTKEMPGFGEQMRQISLNFVP
TAILSRQVAVIRETADRAALIINLPGQPKSIKETLEGLRDAEGKVKVPGIFAAVPYCIDL
IGGPYIETNAAVVTAFRPKSAVRAPRQS