Protein Info for QEN71_RS04225 in Paraburkholderia sabiae LMG 24235

Annotation: 50S ribosomal protein L19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01024: ribosomal protein bL19
  • amino acids 1 to 117 (117 residues), 158.2 bits, E=3.9e-51
• PF01245: Ribosomal_L19
  • amino acids 10 to 117 (108 residues), 154.9 bits, E=3.5e-50

Best Hits

Swiss-Prot: 100% identical to RL19_PARP8: 50S ribosomal protein L19 (rplS) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K02884, large subunit ribosomal protein L19 (inferred from 94% identity to bge:BC1002_2204)

MetaCyc: 67% identical to 50S ribosomal subunit protein L19 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L19p" in subsystem Ribosome LSU bacterial

Protein Sequence (127 amino acids)

>QEN71_RS04225 50S ribosomal protein L19 (Paraburkholderia sabiae LMG 24235)
MNLIAKLEQEEIERALAGKTIPEFAPGDTVIVSVNVVEGNRKRVQAYEGVVIAKRNRGLN
SSFIVRKISSGEGVERTFQTYSPLLASIVVKRRGDVRRAKLYYLRERSGKSARIKEKLVS
KDRAAQA