Protein Info for QEN71_RS04195 in Paraburkholderia sabiae LMG 24235

Annotation: Lrp/AsnC ligand binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13404: HTH_AsnC-type" amino acids 11 to 52 (42 residues), 59.8 bits, see alignment E=2.7e-20 PF13412: HTH_24" amino acids 11 to 58 (48 residues), 62.6 bits, see alignment E=3e-21 PF01037: AsnC_trans_reg" amino acids 77 to 151 (75 residues), 74.9 bits, see alignment E=5.9e-25

Best Hits

Swiss-Prot: 54% identical to LRP_KLEAE: Leucine-responsive regulatory protein (lrp) from Klebsiella aerogenes

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 99% identity to bph:Bphy_0766)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>QEN71_RS04195 Lrp/AsnC ligand binding domain-containing protein (Paraburkholderia sabiae LMG 24235)
MRTQRHPVRALDKLDHKILKILQIDGRIAMKELSEQVGLSVTPCIERVKRMERDGVITGY
HARVNPAELGAALLVFVEITLDHKSGNMFDQFRREVQKIPEVLECHLVSGDFDYLIKARI
GEMADYRKLLGDILLQLPGAVQSKSYVVMEEIKETLTIAVGE