Protein Info for QEN71_RS04040 in Paraburkholderia sabiae LMG 24235

Annotation: HAD-IA family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00702: Hydrolase" amino acids 22 to 197 (176 residues), 103.6 bits, see alignment E=3.8e-33 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 23 to 231 (209 residues), 171.2 bits, see alignment E=4.7e-54 PF13419: HAD_2" amino acids 23 to 202 (180 residues), 116.9 bits, see alignment E=2.3e-37 PF12710: HAD" amino acids 23 to 192 (170 residues), 48.2 bits, see alignment E=3.6e-16 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 112 to 201 (90 residues), 32.2 bits, see alignment E=2.2e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 118 to 197 (80 residues), 38.3 bits, see alignment E=3.4e-13 PF13242: Hydrolase_like" amino acids 159 to 228 (70 residues), 39.6 bits, see alignment E=8.3e-14

Best Hits

Swiss-Prot: 41% identical to MUPP_PSEPK: N-acetylmuramic acid 6-phosphate phosphatase (mupP) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 96% identity to bph:Bphy_0735)

MetaCyc: 41% identical to N-acetyl-beta-muramate 6-phosphate phosphatase (Pseudomonas putida KT2440)
RXN-18659 [EC: 3.1.3.105]

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ubiquinone biosynthesis SAM-dependent O-methyltransferase" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.105 or 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>QEN71_RS04040 HAD-IA family hydrolase (Paraburkholderia sabiae LMG 24235)
MSDPTPLPQREDEEASIGLCQGILFDLDGTLADTAPDLAAAVNRMRHDRGLEMVPLEQLR
PLASAGARGLLGGAFGIGPEHHDYASMRDEFLANYEADLCIETILFPGIGEILDDLDSRG
VRWGIVTNKVARLTEPLVAQLGLDTRAGCVVSGDTTPHSKPHPAPLLHAAKELDLSPERI
VYIGDDLRDVQAGFAAGMVTVAAAYGYCGNDIPPTQWHAKHVVNSTAELLGLLRDIS