Protein Info for QEN71_RS03980 in Paraburkholderia sabiae LMG 24235

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 214 to 240 (27 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 78 to 348 (271 residues), 234.2 bits, see alignment E=9.6e-74 PF01545: Cation_efflux" amino acids 82 to 268 (187 residues), 133.1 bits, see alignment E=5.5e-43

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 83% identity to bph:Bphy_0724)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>QEN71_RS03980 cation diffusion facilitator family transporter (Paraburkholderia sabiae LMG 24235)
MKYTAHQTDGATAQHQPKPDAHVHTDACAHADHDHSHDHDHAHETRGKGAHAHGHAGHAG
HAHGHGHHHHAPTAGHGRAFAIAVALNVAIVVVQAIYGVLANSTALLADAGHNLSDVLGL
LLAWGATWLATRRPSARYTFGLGGSSILASLLNAGLLLFACGVIVAEAVGRLFHPAPVAG
LDVFIVAVVGMVVNGFSAWLFMRGSEGDLNIRGAFLHMLADAAVSAAVAVSGLVILFSGW
TWLDPVMSIIVVAVIVYGTWGLLRDSISLALNGVPPGVDVQKIREYLAAQPGVTDVHDLH
VWALSTTGNALSAHLVIPAGHPGDRMIDGIVGTLRAEFDMHHATLQVDMGTTQHRCSLDS
APHAH