Protein Info for QEN71_RS03970 in Paraburkholderia sabiae LMG 24235

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 6 to 69 (64 residues), 34.3 bits, E=2.6e-11
  • amino acids 73 to 134 (62 residues), 44.5 bits, E=1.6e-14
  • amino acids 142 to 200 (59 residues), 32.7 bits, 8.4e-11
  • amino acids 189 to 236 (48 residues), 17.5 bits, 4.9e-06
  • amino acids 210 to 271 (62 residues), 34.1 bits, E=2.9e-11
  • amino acids 244 to 307 (64 residues), 39.3 bits, E=7e-13
  • amino acids 290 to 331 (42 residues), 20.4 bits, 5.9e-07
• PF13181: TPR_8
  • amino acids 36 to 68 (33 residues), 14.2 bits, see alignment (E = 4.2e-05)
  • amino acids 71 to 101 (31 residues), 18.9 bits, see alignment (E = 1.2e-06)
  • amino acids 105 to 134 (30 residues), 20.4 bits, see alignment (E = 4.2e-07)
  • amino acids 137 to 169 (33 residues), 25.4 bits, see alignment (E = 1.1e-08)
  • amino acids 172 to 202 (31 residues), 16 bits, see alignment (E = 1.1e-05)
  • amino acids 207 to 237 (31 residues), 15.7 bits, see alignment (E = 1.3e-05)
  • amino acids 240 to 271 (32 residues), 20.1 bits, see alignment (E = 5.1e-07)
  • amino acids 275 to 305 (31 residues), 15.7 bits, see alignment (E = 1.3e-05)
• PF07721: TPR_4
  • amino acids 37 to 60 (24 residues), 13.1 bits, see alignment (E = 0.00013)
  • amino acids 71 to 93 (23 residues), 11.6 bits, see alignment (E = 0.00041)
  • amino acids 103 to 127 (25 residues), 18.4 bits, see alignment (E = 2.5e-06)
  • amino acids 138 to 162 (25 residues), 16.8 bits, see alignment (E = 8.4e-06)
  • amino acids 206 to 229 (24 residues), 13.7 bits, see alignment (E = 8.5e-05)
  • amino acids 240 to 264 (25 residues), 15.6 bits, see alignment (E = 2e-05)
• PF13176: TPR_7
  • amino acids 37 to 68 (32 residues), 16.5 bits, see alignment (E = 7.1e-06)
  • amino acids 73 to 100 (28 residues), 16.4 bits, see alignment (E = 7.5e-06)
  • amino acids 105 to 134 (30 residues), 17.3 bits, see alignment (E = 4.1e-06)
  • amino acids 140 to 168 (29 residues), 21 bits, see alignment (E = 2.6e-07)
• PF14559: TPR_19
  • amino acids 47 to 91 (45 residues), 29.1 bits, 1e-09
  • amino acids 81 to 136 (56 residues), 29.6 bits, 7e-10
  • amino acids 183 to 237 (55 residues), 30.6 bits, 3.4e-10
  • amino acids 218 to 276 (59 residues), 28.6 bits, 1.5e-09
  • amino acids 251 to 309 (59 residues), 25.9 bits, 1.1e-08
• PF13424: TPR_12
  • amino acids 70 to 133 (64 residues), 35 bits, E=1.4e-11
  • amino acids 105 to 167 (63 residues), 41.3 bits, E=1.5e-13
• PF13414: TPR_11
  • amino acids 76 to 115 (40 residues), 43.3 bits, 2.4e-14
  • amino acids 110 to 151 (42 residues), 33.7 bits, 2.3e-11
  • amino acids 144 to 185 (42 residues), 27.7 bits, 1.8e-09
  • amino acids 246 to 287 (42 residues), 33.6 bits, 2.5e-11
• PF07719: TPR_2
  • amino acids 104 to 134 (31 residues), 30.8 bits, see alignment (E = 1.9e-10)
  • amino acids 138 to 170 (33 residues), 27.8 bits, see alignment (E = 1.8e-09)
  • amino acids 240 to 271 (32 residues), 23.5 bits, see alignment (E = 4.1e-08)
• PF00515: TPR_1
  • amino acids 105 to 134 (30 residues), 34.6 bits, see alignment (E = 1.2e-11)
  • amino acids 138 to 169 (32 residues), 32.2 bits, see alignment (E = 6.6e-11)
• PF13174: TPR_6
  • amino acids 105 to 130 (26 residues), 12.5 bits, see alignment (E = 0.00021)
• PF13374: TPR_10
  • amino acids 142 to 167 (26 residues), 18.8 bits, see alignment (E = 1.3e-06)

Best Hits

KEGG orthology group: None (inferred from 92% identity to bph:Bphy_0722)

Predicted SEED Role

"TPR repeat"

Protein Sequence (615 amino acids)

>QEN71_RS03970 tetratricopeptide repeat protein (Paraburkholderia sabiae LMG 24235)
MHPVFDRAYSAHRDGRLDDAERGYRATLDLDPAHVDALHLLGVLRHQQGQHEEAADLVRR
AADLRPQDAGLQLNLGNALKALGRLDQAIERFRNALTLAPTFPMAHYNLGNAYALAGRHE
DAVDAFEKSLRLQPMDASSHVNLGNALHALGRHREAVDSFRRALELRPGHAGAHNNIGMA
LNALGSATEASAHFRAALKIEPRFTAARFNLANTLDATGQHEQAVAEFEAVLAMQANLPP
ALFGLGNALASLGRHEEARPRFERAVGLDPNFALAWLSLGAAHHALGAHAAAVRAFDQAL
RLRPDLPMAHMNRGVTLLTLGDFKRGLPEYEWRLENAVASPGAPPLPRWNGEPIEGRTLF
VHAEQGFGDTLQFVRFVEIVAKLAVRVILEVQPQLVPLLAPTAEQWRVTLIAQGAPRPRA
DLQCPLLSLPFALGTQFDSIPARTSYLTAPAASRRTWRGSLGGHAKRKFGIAWSGRAQRQ
ENRSLPLAALEPLFALDGIDWIVLQPELADDERAALDAHPRAKNIHRFDGRIRDFADTAA
IIERLDGVVSVDTSIAHLTGALGKPLWLMLPFAADWRWFTGDQRSPWYPSARLVRQSLPG
EWAEVVEEVAAALRD