Protein Info for QEN71_RS03940 in Paraburkholderia sabiae LMG 24235

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 182 to 209 (28 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 427 to 451 (25 residues), see Phobius details amino acids 471 to 489 (19 residues), see Phobius details amino acids 518 to 541 (24 residues), see Phobius details amino acids 549 to 568 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 377 (365 residues), 208.7 bits, see alignment E=6.3e-66

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 96% identity to bph:Bphy_0716)

Predicted SEED Role

"POTASSIUM/PROTON ANTIPORTER ROSB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (589 amino acids)

>QEN71_RS03940 cation:proton antiporter (Paraburkholderia sabiae LMG 24235)
MHHGIGFIQDLAVVMALAGVVTVLFHRLKQPVVLGYIAAGVIIGPYTPPFQLIHDEQTIQ
TLGELGVVFLMFSLGLEFSLRKLFKVGATAVVAALSEIVLMLWIGYEIGSAFGWSKMDSL
FLGAILAISSTTIIVKALSELGLKRESFAQLVFGILIVEDILAIAMLVLLSGIAQTGELS
AGIAFVTLGKLLLFMTVSLVIGILVVPRALNYVAKSQSDEMLLVSVLGFCFAFCLLVVKL
DYSIALGAFLIGAIMAESRHLHRIEHLIAPLRDAFSAIFFVTIGLMLNPTVLVDYAWPIA
VITIAVILGKIVSCGLGTFLAGKDGRTAMRVGMTVSQIGEFSFIIASLGLTLKVTSAFLY
PIAVAVSALTTLFTPYLIRAADPLTRRVGHAMPRTVANVFGMYGQWLGSLRPASGEPTIF
SLTRRIILQIAVNLAIVAAIFLGASYGAPYVTLYGSGFIEKWLPSEPMQRVVLWSGALIV
SMPFLVAVYRKTKSLALLLAEISVQPAKAGRFTSAIRYAISDLVPVVSMLGVFLLVAALS
STILPPTGLLVAVLLCAALLLTVLWRWCVRIHATMQIALRETFEEQPDP