Protein Info for QEN71_RS03920 in Paraburkholderia sabiae LMG 24235

Annotation: xanthine dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 6 to 484 (479 residues), 696.4 bits, E=8.1e-214
• PF00111: Fer2
  • amino acids 12 to 62 (51 residues), 22.6 bits, 1.6e-08
• PF01799: Fer2_2
  • amino acids 86 to 163 (78 residues), 103.5 bits, E=1.1e-33
• PF00941: FAD_binding_5
  • amino acids 212 to 376 (165 residues), 184.2 bits, E=3.7e-58
• PF03450: CO_deh_flav_C
  • amino acids 383 to 483 (101 residues), 120 bits, E=9e-39

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 92% identity to bph:Bphy_0713)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Protein Sequence (513 amino acids)

>QEN71_RS03920 xanthine dehydrogenase small subunit (Paraburkholderia sabiae LMG 24235)
MTTQTIRFYHQGTVREIGGVPASRTVLQHLREDLHCTGTKEGCAEGDCGACTVVVGEADS
SGQLQLKAVNACIQFLPTLDGKALFTVEDLRAASGALHPAQQAMVDCHGSQCGFCTPGFV
MSMWALYENQPTGAGLPTRDEINTALSGNLCRCTGYRPIVEASQKMFDEQHYPRVALDRA
AVVKALRSIQRSATFEYSAPDTRGDAFGQPTFYAPVTLDAFATLRAQHPHARLLAGSTDV
GLWVTKQFRDLGDILYIGNVAELKTIERDAQTLTIGAAVSLEDAYAALTADYPELAELWT
RFASLPIRNAGTLGGNVANGSPIGDSMPALIALDAQVVLQRERKTRTLPLDAFYIGYQKT
ALEAGEFVAAIRVPRPAQDLRFRTYKVSKRYDQDISAVCAAFALRIADGVIADARIAFGG
MAATPKRAQQAEAALKGAPWDAAAAQRAMTALAADYQPLTDMRASGAYRLKVACNLLWRF
HLETRDADPLALRDVNAFAFDAGALHATQEPTS