Protein Info for QEN71_RS03920 in Paraburkholderia sabiae LMG 24235

Annotation: xanthine dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 TIGR02963: xanthine dehydrogenase, small subunit" amino acids 6 to 484 (479 residues), 696.4 bits, see alignment E=8.1e-214 PF00111: Fer2" amino acids 12 to 62 (51 residues), 22.6 bits, see alignment 1.6e-08 PF01799: Fer2_2" amino acids 86 to 163 (78 residues), 103.5 bits, see alignment E=1.1e-33 PF00941: FAD_binding_5" amino acids 212 to 376 (165 residues), 184.2 bits, see alignment E=3.7e-58 PF03450: CO_deh_flav_C" amino acids 383 to 483 (101 residues), 120 bits, see alignment E=9e-39

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 92% identity to bph:Bphy_0713)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>QEN71_RS03920 xanthine dehydrogenase small subunit (Paraburkholderia sabiae LMG 24235)
MTTQTIRFYHQGTVREIGGVPASRTVLQHLREDLHCTGTKEGCAEGDCGACTVVVGEADS
SGQLQLKAVNACIQFLPTLDGKALFTVEDLRAASGALHPAQQAMVDCHGSQCGFCTPGFV
MSMWALYENQPTGAGLPTRDEINTALSGNLCRCTGYRPIVEASQKMFDEQHYPRVALDRA
AVVKALRSIQRSATFEYSAPDTRGDAFGQPTFYAPVTLDAFATLRAQHPHARLLAGSTDV
GLWVTKQFRDLGDILYIGNVAELKTIERDAQTLTIGAAVSLEDAYAALTADYPELAELWT
RFASLPIRNAGTLGGNVANGSPIGDSMPALIALDAQVVLQRERKTRTLPLDAFYIGYQKT
ALEAGEFVAAIRVPRPAQDLRFRTYKVSKRYDQDISAVCAAFALRIADGVIADARIAFGG
MAATPKRAQQAEAALKGAPWDAAAAQRAMTALAADYQPLTDMRASGAYRLKVACNLLWRF
HLETRDADPLALRDVNAFAFDAGALHATQEPTS