Protein Info for QEN71_RS03850 in Paraburkholderia sabiae LMG 24235

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 805 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 261 to 280 (20 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 314 to 339 (26 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 386 to 410 (25 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details amino acids 664 to 681 (18 residues), see Phobius details amino acids 688 to 708 (21 residues), see Phobius details amino acids 714 to 734 (21 residues), see Phobius details amino acids 746 to 771 (26 residues), see Phobius details amino acids 777 to 796 (20 residues), see Phobius details PF03176: MMPL" amino acids 191 to 431 (241 residues), 32.3 bits, see alignment E=2.6e-12 amino acids 650 to 793 (144 residues), 26 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_0699)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (805 amino acids)

>QEN71_RS03850 MMPL family transporter (Paraburkholderia sabiae LMG 24235)
MLMARQWTKTQLWSIRAAWLVLALVASLYCAWRFTGPSPLETNLLALLPATEADPVAEKA
VDTLANALGDRTVFLVTSKDDDHAKAAAKQFGAALQKSGAFASVTAELPPFDMSQIGALY
MPYRFNLLTRDDRDAIANGSASLHDALMQRIYNPVRGPLATQLADDPFGGLEHWLSALPL
ATSNLDLEDNMLVAHRGDATSVLVVTTLPGSAYETQTQHAVLSAVAQAQTSLKTSFPDAS
VARTGAVFYAESARSASEREVHLIGVASACGIALLMLWVFRSPRLLLFGFVSTALGIVCA
LAATMLVFGKLHLLTLVFGASLIGEAVDYSIQYFVVYLGAGLGQRGGWNARQGARSVRPA
LSVALATSLLGYAILAWVPFPALKQIACFAIVGICTAFASVLWLLPTLLVKGPKRAQRRL
FLRAATLLARWHATIGGRRSWIVAGVLVLIAIPGWLRLTSDDDIHLLIQRDPALVAQEDQ
VRNAIGVDNTAQFFVVRGASQDIVLQRAEALGAKLDALSGAQSVNGWQSVTQFVPSAQRQ
ADARVVLAQHVFNDPAALRSMLLQAGYRDEIADAWIASYAKSNATPLTVERWLAAPWSQP
YRHLWLGAVESHGEHGYAAIVIPQRVTPQNINALIGTARSIEGVVFVDKAASVSKLFGAY
RVDSGIWLAGALLLVLILLMVRYTPRGGIATTLPVLLAIGVTLAAFGYARVPLNLFNCLA
LMLVLGVGANYAVFLREGCLRDHADLGAVWTGVLLSAATTLLSFGMLALSAMPALKSFGA
TLALGILVSVLLAPIGMPPGRRRVA