Protein Info for QEN71_RS03460 in Paraburkholderia sabiae LMG 24235

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 10 to 459 (450 residues), 400.3 bits, see alignment E=5.9e-124 PF02321: OEP" amino acids 59 to 250 (192 residues), 80.2 bits, see alignment E=9.1e-27 amino acids 276 to 457 (182 residues), 104.5 bits, see alignment E=3.2e-34

Best Hits

Swiss-Prot: 39% identical to OPRM_PSEAE: Outer membrane protein OprM (oprM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_5505)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>QEN71_RS03460 efflux transporter outer membrane subunit (Paraburkholderia sabiae LMG 24235)
MRRVLLIGPLCALTLSGCLLGPNYSRPQVEVPATYRFPDNYASDVANTEWWKQFDDPVLN
DLITTALANNNDVKVAAARVDQFLGQFVTTRAALLPHVDAGFDAERQRIPTTSPLFSNIT
SPVFNSYQLALSASWEIDLFGHNRRLTEAARASLLSTEEAKRGTILTLVSSVASSYINLR
SLDRQLEIAKATTSSRAESVHVFELRFKGGEVSQMELAQSQSEYEDSRSRIPQIESQIAQ
QEDALSVLLGRNPGDILRGRALGELAAPAVPAGLPSDLLERRPDLRQAEQDLVSANAQIG
AAKALYFPQISITGLLGTQSGQFSKLFTGPARVWSFAGSVTQPIFEGGAIAGQVKQAEAV
QQQALYSYRKAIQVAFQEVDDALISSQKLREQFDIQGRQVEALATYAHMARLRYEGGYTS
YIEVLDAERSLFNAQLSQTQTQAGVLVSYVSLYKAMGGGWIITAEGMTTTQAHAGDTQQP
DNAAEKQDVK